PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00048082-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 48aa    MW: 5728.41 Da    PI: 4.5881
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00048082-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.19.6e-09240343
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43
                       ++++E++l+ ++ ++lG + W++Ia +++  R + ++  +
  PSME_00048082-RA  2 DFSEDEEDLIRRLYNLLGQR-WALIAGRIP-SRNADEIEKY 40
                      59*****************9.*********.9*99988766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.577148IPR017930Myb domain
PfamPF002494.7E-8240IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-11340IPR009057Homeodomain-like
CDDcd001672.72E-5341No hitNo description
SuperFamilySSF466898.58E-7341IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 48 aa     Download sequence    Send to blast
MDFSEDEEDL IRRLYNLLGQ RWALIAGRIP SRNADEIEKY CSKQYASY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0821227e-55EF082122.1 Picea sitchensis clone WS02813_H08 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009417220.11e-18PREDICTED: MYB-like transcription factor ETC1 isoform X1
TrEMBLA9NLI83e-24A9NLI8_PICSI; Putative uncharacterized protein
STRINGGSMUA_Achr10P09220_0014e-17(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.12e-14MYB_related family protein